PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Z2BLJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 338aa    MW: 37790.6 Da    PI: 4.4823
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Z2BLJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.6e-1961114356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ eq+++Le+ Fe ++++  +++ +LA++lgL+ rqV vWFqNrRa++k
  Aradu.Z2BLJ  61 KKRRLSVEQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWK 114
                  456899***********************************************9 PP

2HD-ZIP_I/II130.37.6e-4260151192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrls eqvk+LE++Fe e+kLep+rKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y+alk + e+L++++++L++e+k
  Aradu.Z2BLJ  60 EKKRRLSVEQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYEALKLNFEKLQQDNQALHKEIK 151
                  69**************************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-2044118IPR009057Homeodomain-like
PROSITE profilePS5007117.37856116IPR001356Homeobox domain
SMARTSM003892.7E-1859120IPR001356Homeobox domain
CDDcd000861.44E-1661117No hitNo description
PfamPF000467.2E-1661114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-2063123IPR009057Homeodomain-like
PRINTSPR000319.9E-68796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000319.9E-696112IPR000047Helix-turn-helix motif
PfamPF021831.3E-17116158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MKRLSSSDDS LGALMTICPS STTEEHSPRN KQQVYGREFQ SMLDGLDEDG CIEESGHHGE  60
KKRRLSVEQV KALEKNFEVE NKLEPDRKVK LAQELGLQPR QVAVWFQNRR ARWKTKQLER  120
DYGVLKANYE ALKLNFEKLQ QDNQALHKEI KGLKSRMQDE RTESDASVKK EQVEMITTLQ  180
DSEENPCDLE TAAAIAGSDS NKDLSYDCFN KGDGEGGDGV GVAASISLFP CGDLKDGSSD  240
SDSSAILNEE NNNSSCSPMN NAAMSSCGGG VLQSSNLLMS QHDESPSSMS CFQFQKAYQA  300
TQYVKMEEHN FFSADETCNF FSDEQAPTLQ WYCSEEWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108116RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015957630.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A0B2PBB71e-150A0A0B2PBB7_GLYSO; Homeobox-leucine zipper protein ATHB-16
STRINGGLYMA05G30940.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-75homeobox protein 6